DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYC and CBF1

DIOPT Version :9

Sequence 1:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens
Sequence 2:NP_012594.1 Gene:CBF1 / 853523 SGDID:S000003821 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:49/249 - (19%)
Similarity:86/249 - (34%) Gaps:96/249 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   213 PLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEI 277
            |.|:...|.:  |.:....||     :.||:.|......||..|:..|        |.|:|:|:.
Yeast   139 PSNEGVKPNT--SLEGMTSSP-----MESTQQSKNDMLIPLAEHDRGP--------EHQQDDEDN 188

Human   278 DVVSVEKRQ----APGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAK 338
            |...::.::    .||:|                                               
Yeast   189 DDADIDLKKDISMQPGRR----------------------------------------------- 206

Human   339 RVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNE 403
                           .||.|:..::|..:..::.:|..:||:||..:..:...|.|.:|..|:: 
Yeast   207 ---------------GRKPTTLATTDEWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESS- 255

Human   404 KAPKVVILKKATAYILSVQAEE---------QKLISEEDL--LRKRREQLKHKL 446
               |..||..|..||..::..:         |||:||::.  |....|:|:.:|
Yeast   256 ---KAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEEL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYCNP_002458.2 Myc_N 21..360 CDD:279405 24/150 (16%)
HLH 370..426 CDD:238036 15/64 (23%)
Myc-LZ 423..453 CDD:280500 9/35 (26%)
CBF1NP_012594.1 HLH 220..272 CDD:238036 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.