powered by:
Protein Alignment MYC and hlh-8
DIOPT Version :9
Sequence 1: | NP_002458.2 |
Gene: | MYC / 4609 |
HGNCID: | 7553 |
Length: | 454 |
Species: | Homo sapiens |
Sequence 2: | NP_509367.1 |
Gene: | hlh-8 / 181069 |
WormBaseID: | WBGene00001953 |
Length: | 178 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 26/67 - (38%) |
Similarity: | 35/67 - (52%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Human 361 RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEE 425
|.::.|...:|...|..||||..||..:|..||..||.:. ::|..|:..|:.||.|| |...|.
Worm 12 RKNEVENVQQRACANRRERQRTKELNDAFTLLRKLIPSMP-SDKMSKIHTLRIATDYI-SFLDEM 74
Human 426 QK 427
||
Worm 75 QK 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.