DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYC and mdl-1

DIOPT Version :9

Sequence 1:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens
Sequence 2:NP_509136.1 Gene:mdl-1 / 180942 WormBaseID:WBGene00003163 Length:281 Species:Caenorhabditis elegans


Alignment Length:229 Identity:50/229 - (21%)
Similarity:83/229 - (36%) Gaps:75/229 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   227 DSSAFSPSSDSL--LSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPG 289
            |..|...||..|  |:||.||| ||..|.:.              :..:|.|:..:...|.:...
 Worm    18 DIGALDISSLDLGALTSTSSSP-GSSSPAMF--------------DLSNESELRSLFCGKLKVDK 67

Human   290 KRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNN 354
            |:|...|                   :.||....|.:.|..||                      
 Worm    68 KQSSCAS-------------------NASTSSQPYCSSPPARK---------------------- 91

Human   355 RKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYIL 419
                |.:.|       |..||.||:.||..|:.....|:..:|.:.:..:...:.:|.:|..:|:
 Worm    92 ----SSKHS-------RTAHNELEKTRRANLRGCLETLKMLVPCVSDATRNTTLALLTRARDHII 145

Human   420 SVQ---AEEQKLISEEDLLRKRREQLKHKLEQLR 450
            .:|   |.:.|.:::   ||..:::|..:|.||:
 Worm   146 ELQDSNAAQMKKLND---LRDEQDELVAELAQLQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYCNP_002458.2 Myc_N 21..360 CDD:279405 26/134 (19%)
HLH 370..426 CDD:238036 15/58 (26%)
Myc-LZ 423..453 CDD:280500 8/28 (29%)
mdl-1NP_509136.1 bHLHzip_Mad 97..172 CDD:381407 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.