DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYC and hlh-11

DIOPT Version :9

Sequence 1:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens
Sequence 2:NP_499129.2 Gene:hlh-11 / 176360 WormBaseID:WBGene00001955 Length:431 Species:Caenorhabditis elegans


Alignment Length:247 Identity:56/247 - (22%)
Similarity:84/247 - (34%) Gaps:91/247 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   265 SDSEEE------------QEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHV 317
            |||.||            :||||.:               .||:.:.         |:.:...:.
 Worm     4 SDSAEEDQIIIDDGFDLTEEDEEMM---------------SSGTGAL---------PVTIADWNS 44

Human   318 STHQHNYAAPPSTRKDYPAAKRVKL------DSVRVLRQISN--------NRKCTSPR------- 361
            .|:..  .||||...   ||....|      :|:|.:...|.        ||..:.|.       
 Worm    45 VTNAR--MAPPSIMS---AASAFDLTASGMQNSLRSVLPTSTIGHAPMLANRSLSQPAPLSPTSL 104

Human   362 SSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYI-------- 418
            ..|....::|:..|..||:|...:...|.|||..:|..| .||..|..||::....:        
 Worm   105 DPDRRSRMRRQIANCNERRRMQSINAGFLALRALLPRKE-GEKLSKAAILQQTADMVHQLLGHKG 168

Human   419 --LSVQAEEQKLISEED---------------LL---RKRREQLKHKLEQLR 450
              :....|.:||..|||               :|   |..|:.|:.::.|||
 Worm   169 EDIPDGGEPKKLKLEEDHHDADHQAQIAHLQTILETERAARKALESQVIQLR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYCNP_002458.2 Myc_N 21..360 CDD:279405 25/120 (21%)
HLH 370..426 CDD:238036 17/65 (26%)
Myc-LZ 423..453 CDD:280500 13/46 (28%)
hlh-11NP_499129.2 HLH 113..163 CDD:278439 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.