DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS14 and YOL162W

DIOPT Version :9

Sequence 1:NP_001286591.1 Gene:MFS14 / 46085 FlyBaseID:FBgn0010651 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:41/222 - (18%)
Similarity:81/222 - (36%) Gaps:62/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LLMQIPTYMKKIYHVDIKKG-------ALLSSLPYMVM-LLLSFFFVWLSKVLQKKEGMSL---- 347
            ||..|||.:...|...:.:.       |.|.::|..|: :||.|...|.::....:.|:||    
Yeast     3 LLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWSTEKCNNRLGLSLLQPL 67

  Fly   348 ----------SFNRKIFNSIGHWIPMLSLIALGYVPADNAPLAVTLLT------LTVGISGATYL 396
                      .:...:||..|.:..:..::...|:.|    :.|:|.:      .|..:|...|.
Yeast    68 YTVPLLAVLRFWKGTMFNKWGTYAIITLILDNPYIHA----ICVSLCSRNSQSVKTRTVSTCLYN 128

  Fly   397 GFQVNHIDLSPN-YAGTLMGITNCAANVMSGIA----PVIVGQIVVDETSVTEWRLVFLLAAAFY 456
            .|....:.:|.| ||.:...:......|:.|:|    |:::|                       
Yeast   129 MFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLALFMFPILIG----------------------- 170

  Fly   457 FLGNLLFVIFGRTEVQWWDSPRDNKED 483
              ..|::|...:...:.|::..:.::|
Yeast   171 --SKLIYVYINKQRDKRWNAMSEEEKD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS14NP_001286591.1 2A0114euk 19..477 CDD:129972 40/214 (19%)
MFS 81..466 CDD:119392 39/203 (19%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.