DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS14 and YOL163W

DIOPT Version :9

Sequence 1:NP_001286591.1 Gene:MFS14 / 46085 FlyBaseID:FBgn0010651 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:35/161 - (21%)
Similarity:59/161 - (36%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LATSGFIADSVLGWPSIFYLGGACGFIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGKMQS 260
            |...||:||.|| |.|.||...........||...|.:     ::|:......:...|..|.|..
Yeast    29 LFEGGFVADLVL-WMSYFYSSSELSIRLSFFWVTLSLT-----QIITSIVAFGVFHMRGIGGMAG 87

  Fly   261 AEKLAPTPWKAIFSSLPFLSLLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGALLSSLPYMVM 325
                    |:.:|......:|::    .|..|:|::..: ...||.:.   |||........:: 
Yeast    88 --------WQWLFLIERIFTLVI----GISAYFLMVPSV-VQTKKPWS---KKGWFTEREEKII- 135

  Fly   326 LLLSFFFVWLSKVLQ---------KKEGMSL 347
                     ::|:|:         .::||||
Yeast   136 ---------VNKILRDDPTKGDMNNRQGMSL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS14NP_001286591.1 2A0114euk 19..477 CDD:129972 35/161 (22%)
MFS 81..466 CDD:119392 35/161 (22%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 31/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.