DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS14 and Slc17a9

DIOPT Version :9

Sequence 1:NP_001286591.1 Gene:MFS14 / 46085 FlyBaseID:FBgn0010651 Length:497 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:381 Identity:93/381 - (24%)
Similarity:162/381 - (42%) Gaps:81/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KTGGKYANEKFFGVRHVQ----CILCFFCLAMSYAWRVNLSVALVAMTDNSTSLAQNNTNTGVAP 69
            ||....|.:|.:.....|    .:|...||.  |..||.:.|..|||:.:               
  Rat    18 KTPSAAAEDKRWSRPECQLWTGMLLLGTCLL--YCTRVTMPVCTVAMSQD--------------- 65

  Fly    70 SEPGFDFFNSERYYNFTQKEKGNLQASFFFGYIVTQVPGGYIAQRYGAKTMLMYGLGIAALITML 134
                         :.:.:||.|.:.:|||:||.:|||.||::..|.|.:.:::........||:.
  Rat    66 -------------FGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVT 117

  Fly   135 SPMSLQFGWVALAVM---RFVMGLAQGAVHPATHALLAKWSPADERGMLGTLCYSGAQFGTVVML 196
            :|:....|...||.:   |.:.||.||...||..:||::.....||....:...:|:|.||:|  
  Rat   118 TPLLAHLGSGHLAFVTFSRILTGLLQGVYFPALTSLLSQRVQESERSFTYSTVGAGSQVGTLV-- 180

  Fly   197 ATSGFIADSVL----GWPSIFYLGGACGFIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGK 257
             |.|.  .|||    ||.|:||..|....:|:  :|::.....|:..:::.|.|           
  Rat   181 -TGGI--GSVLLDRCGWQSVFYFSGGLTLLWV--YYVYKYLLDEKDLVLALGVL----------- 229

  Fly   258 MQSAEKLAPT-----PWKAIFSSLPFLSLLVVHCTHIFGYWLLLMQIPTYMKKIY-HVDIKKGAL 316
               |:.|..|     ||:.:|......:::....:....:::||..:||:.|:.: |   .||.:
  Rat   230 ---AQGLPVTRPSKVPWRQLFRKASVWAVICSQLSSACSFFILLSWLPTFFKETFPH---SKGWV 288

  Fly   317 LSSLPYMVMLLLSFFFVWLSKVLQKKEGMSLSFNRKIFN---------SIGHWIPM 363
            .:.:|:::.:..|.|..::|..| ..:|..:...||...         |:.|:.|:
  Rat   289 FNVVPWLLAIPASLFSGFISDRL-ISQGYRVITVRKFMQPCPAGHGPWSVKHFCPV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS14NP_001286591.1 2A0114euk 19..477 CDD:129972 89/371 (24%)
MFS 81..466 CDD:119392 78/305 (26%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 85/342 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.