DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS14 and C25H3.15

DIOPT Version :9

Sequence 1:NP_001286591.1 Gene:MFS14 / 46085 FlyBaseID:FBgn0010651 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001021983.1 Gene:C25H3.15 / 3565066 WormBaseID:WBGene00044391 Length:159 Species:Caenorhabditis elegans


Alignment Length:52 Identity:14/52 - (26%)
Similarity:22/52 - (42%) Gaps:6/52 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 WIPMLSLIALGYVPADNAPLAVTLLTLTVGISGATY----LGFQVNHIDLSP 407
            :||:..::.|  :..|.||.:.:.......||..||    ....:||..|.|
 Worm     8 FIPIFIILVL--LKVDAAPPSGSFFWTDREISCVTYDVNRTRCVLNHPQLGP 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS14NP_001286591.1 2A0114euk 19..477 CDD:129972 14/52 (27%)
MFS 81..466 CDD:119392 14/52 (27%)
C25H3.15NP_001021983.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.