DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and SBH1

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_011011.3 Gene:SBH1 / 856821 SGDID:S000002128 Length:82 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:27/79 - (34%)
Similarity:44/79 - (55%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSAPRSAGSGGGSTLKQRKTTTSTTAARSRAP--GGAGTGGMWRFYTDDSPGIKVGPVPVLVMSL 82
            :|:|  ...||..||::||..:|...|.| ||  .......:.:.|:|::.|::|.|:.||.:::
Yeast     1 MSSP--TPPGGQRTLQKRKQGSSQKVAAS-APKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAV 62

  Fly    83 LFIASVFMLHIWGK 96
            .||.||..||:..|
Yeast    63 GFIFSVVALHVISK 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 13/36 (36%)
SBH1NP_011011.3 Sec61_beta 38..74 CDD:397820 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I1883
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - O PTHR13509
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.