DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and SBH2

DIOPT Version :10

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_010936.1 Gene:SBH2 / 856740 SGDID:S000002127 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:20/65 - (30%)
Similarity:39/65 - (60%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TLKQRKTTTSTTAARSRAPGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKY 97
            ::|:::...:.|:.|....||: :..:.:.|||::.|.:|..:.||.:|:.||.||..||:..|:
Yeast    21 SIKEKQAKQTPTSTRQAGYGGS-SSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHLLTKF 84

  Fly    98  97
            Yeast    85  84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:427582 14/36 (39%)
SBH2NP_010936.1 Sec61_beta 45..81 CDD:427582 14/35 (40%)

Return to query results.
Submit another query.