DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and AT3G60540

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001327136.1 Gene:AT3G60540 / 825225 AraportID:AT3G60540 Length:81 Species:Arabidopsis thaliana


Alignment Length:74 Identity:34/74 - (45%)
Similarity:46/74 - (62%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGGSTLKQRKTTTSTTAARSRAP------GGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIAS 87
            |||:  .||.:..:|.:.|.|.|      .|.|.|.|.:|||||:||:|:.|..||:||:.|||.
plant     3 GGGA--PQRGSAAATASMRRRKPAGGSSSAGGGAGTMLQFYTDDAPGLKISPNVVLIMSIGFIAF 65

  Fly    88 VFMLHIWGK 96
            |.:||:.||
plant    66 VAVLHVMGK 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 20/36 (56%)
AT3G60540NP_001327136.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4327
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2472
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - otm2663
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - O PTHR13509
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.