DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and sec61b

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001002527.1 Gene:sec61b / 791986 ZFINID:ZDB-GENE-040718-260 Length:97 Species:Danio rerio


Alignment Length:101 Identity:69/101 - (68%)
Similarity:82/101 - (81%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAP-ASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYT 64
            ||.| ||:|:||:.||||||..|||:|    |::.:|||.|:|:..:..|:...|||||||||||
Zfish     1 MPGPAASATNVGASSRSPSKTVAPRTA----GTSARQRKATSSSARSGGRSTASAGTGGMWRFYT 61

  Fly    65 DDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS 100
            :||||:|||||||||||||||||||||||||||.||
Zfish    62 EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 34/36 (94%)
sec61bNP_001002527.1 Sec61_beta 54..91 CDD:281849 34/36 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592333
Domainoid 1 1.000 84 1.000 Domainoid score I8244
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38229
Inparanoid 1 1.050 138 1.000 Inparanoid score I4510
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - oto41765
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - LDO PTHR13509
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1290
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.