DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and Sec61b

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_077133.1 Gene:Sec61b / 66212 MGIID:1913462 Length:96 Species:Mus musculus


Alignment Length:101 Identity:67/101 - (66%)
Similarity:76/101 - (75%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAPA-SSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYT 64
            ||.|. |.|:|||..|||||..|.|:|    |||::|||..:..|.:..|.. .|||||||||||
Mouse     1 MPGPTPSGTNVGSSGRSPSKAVAARAA----GSTVRQRKNASCGTRSAGRTT-SAGTGGMWRFYT 60

  Fly    65 DDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS 100
            :||||:||||||||||||||||:||||||||||.||
Mouse    61 EDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 33/36 (92%)
Sec61bNP_077133.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 27/57 (47%)
Sec61_beta 54..91 CDD:397820 33/36 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8253
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38229
Inparanoid 1 1.050 127 1.000 Inparanoid score I4660
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59774
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - otm44044
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13509
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1290
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.960

Return to query results.
Submit another query.