DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and Sec61b

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001100124.1 Gene:Sec61b / 298068 RGDID:1304997 Length:96 Species:Rattus norvegicus


Alignment Length:101 Identity:68/101 - (67%)
Similarity:77/101 - (76%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAPA-SSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYT 64
            ||.|. |:|:|||..|||||..|.|:|    |||::|||..:..|.:..|.. .|||||||||||
  Rat     1 MPGPTPSATNVGSSGRSPSKAVAARAA----GSTVRQRKNASCGTRSAGRTT-SAGTGGMWRFYT 60

  Fly    65 DDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS 100
            :||||:|||||||||||||||||||||||||||.||
  Rat    61 EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 34/36 (94%)
Sec61bNP_001100124.1 Sec61_beta 54..91 CDD:397820 34/36 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350626
Domainoid 1 1.000 84 1.000 Domainoid score I8088
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38229
Inparanoid 1 1.050 128 1.000 Inparanoid score I4571
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - oto98302
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - LDO PTHR13509
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.