DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and AT5G60460

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001318850.1 Gene:AT5G60460 / 28721282 AraportID:AT5G60460 Length:109 Species:Arabidopsis thaliana


Alignment Length:108 Identity:42/108 - (38%)
Similarity:54/108 - (50%) Gaps:37/108 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STSVGSGSRSPSKLSAPR-----SAG-------------SGGGSTLKQRKTTTSTTAARSRAPGG 53
            |||.||.:..|. |:|||     :||             |||||.:                  |
plant    11 STSTGSSTARPG-LAAPRGSAAATAGMRRRRLGGGGGVSSGGGSGV------------------G 56

  Fly    54 AGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGK 96
            :|:..|.||||||:||:|:.|..||:|||.||..|..||::||
plant    57 SGSSNMLRFYTDDAPGLKISPTVVLIMSLCFIGFVTALHVFGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 21/36 (58%)
AT5G60460NP_001318850.1 Sec61_beta 61..98 CDD:397820 21/36 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4327
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2472
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - otm2663
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - LDO PTHR13509
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.