DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and sec-61.B

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_500197.1 Gene:sec-61.B / 177027 WormBaseID:WBGene00021427 Length:81 Species:Caenorhabditis elegans


Alignment Length:91 Identity:48/91 - (52%)
Similarity:61/91 - (67%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYTDDSPGIKVGP 74
            :....|||    .|.:.|      ::|||...:...||:||  |...||:|||||:||.|:|:||
 Worm     1 MADSGRSP----RPTTGG------VRQRKGGAAAAPARARA--GGNNGGLWRFYTEDSTGLKIGP 53

  Fly    75 VPVLVMSLLFIASVFMLHIWGKYNRS 100
            ||||||||:||||||:||||||:.||
 Worm    54 VPVLVMSLVFIASVFVLHIWGKFTRS 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 29/36 (81%)
sec-61.BNP_500197.1 Sec61_beta 36..73 CDD:281849 29/36 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164686
Domainoid 1 1.000 77 1.000 Domainoid score I5769
eggNOG 1 0.900 - - E1_KOG3457
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I3642
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 1 1.000 - - FOG0003210
OrthoInspector 1 1.000 - - oto19659
orthoMCL 1 0.900 - - OOG6_103007
Panther 1 1.100 - - LDO PTHR13509
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1290
SonicParanoid 1 1.000 - - X3687
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.