DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61beta and sec61b

DIOPT Version :9

Sequence 1:NP_652037.1 Gene:Sec61beta / 46080 FlyBaseID:FBgn0010638 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001103514.1 Gene:sec61b / 100038128 XenbaseID:XB-GENE-493431 Length:96 Species:Xenopus tropicalis


Alignment Length:101 Identity:71/101 - (70%)
Similarity:82/101 - (81%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAP-ASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYT 64
            ||.| ||:|:||:.||||||..|||:|    |||::|||..:|:|.:..|.. .|||||||||||
 Frog     1 MPGPAASATNVGASSRSPSKAVAPRTA----GSTVRQRKNASSSTRSAGRTT-SAGTGGMWRFYT 60

  Fly    65 DDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS 100
            :||||:|||||||||||||||||||||||||||.||
 Frog    61 EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61betaNP_652037.1 Sec61_beta 58..95 CDD:397820 34/36 (94%)
sec61bNP_001103514.1 Sec61_beta 54..91 CDD:377160 34/36 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38229
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59774
OrthoDB 1 1.010 - - D1634609at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13509
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1290
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.