DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPH and CG14964

DIOPT Version :9

Sequence 1:NP_004988.2 Gene:MYBPH / 4608 HGNCID:7552 Length:477 Species:Homo sapiens
Sequence 2:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster


Alignment Length:555 Identity:120/555 - (21%)
Similarity:187/555 - (33%) Gaps:155/555 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    47 PQAPAPQAPTA-STATKPAPPSEDVPSAPLL--LTLDDVSSSSVTVSWEPPERLGRLGLQGYVLE 108
            ||...|:.... .:|.:|:||..     |:|  :.|.:.....|.:.|:.|...|...:.||.:|
  Fly    12 PQGGRPKKNVHWKSAERPSPPGR-----PILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVE 71

Human   109 LCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIR------- 166
            ..|.|:..||..:..|:......:..|..|.::..|..|.:..|....:.|..|:.:.       
  Fly    72 HRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNAIT 136

Human   167 ----------------ENIE--------------------------------------------- 170
                            |.||                                             
  Fly   137 VPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVA 201

Human   171 ----------------------------APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQAT 207
                                        .||||:||......|.:..|.:.|::...|:|.|..|
  Fly   202 LTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAIT 266

Human   208 WTHNGHAL-DSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPS 271
            |.|.|..: ...|..:...:::|:|.|.:..|.|.|.|.:.......|......:.|..:|.||.
  Fly   267 WLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPG 331

Human   272 SIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSY 336
            :.:|...:|.:|.|.||.|.|.|..::..|:|:........|.........:| |:.|||.|:.|
  Fly   332 TPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALST-TLHDLIEGSEY 395

Human   337 SFRVFSENLCGLSTSATVTKELAHI--QKADIAAKPKGF--IERDFSEAP--------------- 382
            .|||.:||..||| ..:...||..|  .|..| .|||..  |..|..:.|               
  Fly   396 KFRVKAENPYGLS-EPSGESELLFIPDPKRGI-TKPKSATRIAGDEKDKPKTGAGGMQVPPRRKT 458

Human   383 -SFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKN--------------KMEIQGNPKYRALS 432
             |..:|.||  ::.|.|.:...|.:..|||::|..:.              ||:::.:|...:..
  Fly   459 LSPPRPQAD--ASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSAD 521

Human   433 EQGVCTLEIRKP-----------SPFDSGVYTCKA 456
            .....|.:...|           :|.|..|.:.||
  Fly   522 SANKPTTDSSNPKLNLTLVTTTLAPLDKSVPSPKA 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPHNP_004988.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 7/26 (27%)
UBQ <4..>69 CDD:333228 7/22 (32%)
FN3 71..157 CDD:238020 20/87 (23%)
Ig 191..263 CDD:325142 17/72 (24%)
FN3 267..355 CDD:238020 30/87 (34%)
I-set 382..471 CDD:254352 22/116 (19%)
CG14964NP_647779.2 FN3 29..127 CDD:238020 25/102 (25%)
I-set 138..227 CDD:254352 3/88 (3%)
Ig 155..224 CDD:143165 2/68 (3%)
IG_like 243..323 CDD:214653 19/79 (24%)
Ig 250..323 CDD:299845 17/72 (24%)
FN3 327..411 CDD:238020 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.