DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vlc and DLGAP5

DIOPT Version :9

Sequence 1:NP_001163056.1 Gene:vlc / 46078 FlyBaseID:FBgn0259978 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_055565.3 Gene:DLGAP5 / 9787 HGNCID:16864 Length:846 Species:Homo sapiens


Alignment Length:597 Identity:126/597 - (21%)
Similarity:209/597 - (35%) Gaps:185/597 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PVSVRDITR-------EFTANLRERCVPNLPPQPQHKTPAYVESRSSELEHMVLSPAIVECDQEP 91
            |.||| |||       |.|....|..|..:.|.|:..:    |.:.|:.|..|:.|.:      |
Human   147 PSSVR-ITRSKAKDQMEQTKIDNESDVRAIRPGPRQTS----EKKVSDKEKKVVQPVM------P 200

  Fly    92 SSNDFDETSAENSQEAPEKKPSYLNLACCVNGYSNLTTYDSKIRQDINKSREVSPI----RPSTS 152
            :|.....::.:.:::.|....|              ||....:.:..|::.....:    ||:.:
Human   201 TSLRMTRSATQAAKQVPRTVSS--------------TTARKPVTRAANENEPEGKVPSKGRPAKN 251

  Fly   153 SLQYCKRNHFLATPTLHSMPSPATKCKPIEPNNNSNDSSGNFSSGSGHSNGNGSFIK-QRVERLY 216
                           :.:.|.....|| ::...|:.:|..|.:||   .|.:|...| :.:..:.
Human   252 ---------------VETKPDKGISCK-VDSEENTLNSQTNATSG---MNPDGVLSKMENLPEIN 297

  Fly   217 GPGALAQGFYSPKKHGQSPSNA---------AGRSERG-----------QVEIDSLQGSE--LAR 259
            ......:..::||.....|.:.         ..||...           :.|:|..|.::  ||:
Human   298 TAKIKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEILAQ 362

  Fly   260 KFKQLSPSKDYGEFRKKMQKKCSQSTTARIDEPLH-----SPGLNGDLDLPVFRHLSQEFRAQLP 319
            |.|..| :|...:...|:.......|....:..|:     :..|||   ||:         .::|
Human   363 KCKTYS-TKTIQQDSNKLPCPLGPLTVWHEEHVLNKNEATTKNLNG---LPI---------KEVP 414

  Fly   320 TVSPKRGAPRSCMAPDVLLVDNESSPDHGPTDEVDHESTKMDKLASEEYISTSNISVEAVVKDGN 384
            ::....|              ..:.|.||..                                  
Human   415 SLERNEG--------------RIAQPHHGVP---------------------------------- 431

  Fly   385 FFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTFGLLRSASGKARLLVSQKMKQFEGLCHN 449
            :|..||:.|..:|.......::..:.     ||.:|...|:|:|.|:.|||:.::.||||||..:
Human   432 YFRNILQSETEKLTSHCFEWDRKLEL-----DIPDDAKDLIRTAVGQTRLLMKERFKQFEGLVDD 491

  Fly   450 -NLNRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSIFADIEKLKSNDWKVKAQSVADQPDLHTIPT 513
             ...|..::   ||..||.||||||..|:|.|...|.::.||:.:.|:|       ..:::....
Human   492 CEYKRGIKE---TTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQV-------NNNMNHNMN 546

  Fly   514 KTIKPSKVGVSQVKTVGKASSVRVNGSAPPPPNSAAALKREAQRKLLLEMKRQRRE-------AM 571
            |.:...||               |:|.|..|....|.  |.|.|..|..:|...||       |.
Human   547 KNVFRKKV---------------VSGIASKPKQDDAG--RIAARNRLAAIKNAMRERIRQEECAE 594

  Fly   572 TAAAKLNPINVD 583
            ||.:.: |..||
Human   595 TAVSVI-PKEVD 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlcNP_001163056.1 GKAP 246..575 CDD:281368 80/343 (23%)
DLGAP5NP_055565.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..284 31/173 (18%)
GKAP <432..599 CDD:308780 58/198 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 628..674
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.