DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vlc and Il1rapl1

DIOPT Version :9

Sequence 1:NP_001163056.1 Gene:vlc / 46078 FlyBaseID:FBgn0259978 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_808796.1 Gene:Il1rapl1 / 317553 RGDID:727891 Length:696 Species:Rattus norvegicus


Alignment Length:160 Identity:36/160 - (22%)
Similarity:61/160 - (38%) Gaps:51/160 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DFDETSA-ENSQEAPEK-----KPSYLN----LAC-------CVNGYSNLTT--------YDSKI 134
            ||:|..| :.|:.:.|:     :|:.|.    .||       |:....:||.        |:||:
  Rat    84 DFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKM 148

  Fly   135 ----RQDINKSREVS---------PIR-PSTSSLQYCKRNHFLATPTLHSMPSPATKCKPIEPNN 185
                :.:::||:|:|         |.| |.....:.|:      |.|..  ||...|...:....
  Rat   149 KYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECR------TKTWR--PSIVFKRDTLLIKE 205

  Fly   186 NSNDSSGNFSSGSGHSNGNGSFIKQRVERL 215
            ...|..||::....:    |.|:.:|...|
  Rat   206 VKEDDIGNYTCELKY----GGFVVRRTTEL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlcNP_001163056.1 GKAP 246..575 CDD:281368
Il1rapl1NP_808796.1 PHA02785 9..334 CDD:165149 36/160 (23%)
Ig1_IL1RAPL-1_like 32..135 CDD:143304 12/50 (24%)
Ig 148..234 CDD:299845 20/96 (21%)
IGc2 260..341 CDD:197706
TIR 405..559 CDD:279864
Interaction with NCS1. /evidence=ECO:0000250 549..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.