DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vlc and il1rapl2

DIOPT Version :9

Sequence 1:NP_001163056.1 Gene:vlc / 46078 FlyBaseID:FBgn0259978 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001136056.1 Gene:il1rapl2 / 100149452 ZFINID:ZDB-GENE-040219-5 Length:681 Species:Danio rerio


Alignment Length:293 Identity:54/293 - (18%)
Similarity:106/293 - (36%) Gaps:102/293 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 CMAPDVLLVDNESSPDHGPTDEVDHESTKMDKLASEEYISTSNISVEAVVKDGNFFLKILKEEQS 395
            |...:::|...:    |..:||.|..:.:.|     .|:|.:.:.:::|.::      :.:|||.
Zfish   376 CYNVEIMLCYRQ----HFGSDEADDGNKEYD-----AYLSYTKVDLDSVEQE------MSEEEQF 425

  Fly   396 RLLVLAALAEK---------YADALSTNPDISEDTFGLLRSASGKARLLV----------SQKMK 441
            .|.:|..:.||         :.|.:.::..|.:    |.||.....||::          ...:.
Zfish   426 ALEILPDVLEKHYGYKLFIPHRDLIPSSTYIED----LARSVEQSRRLIIVLTPEFVARRGWSIF 486

  Fly   442 QFEGLCHNNLNRSPEDKFPTTLDDLQGFWDMVYLQVEHVDSI--FADIEKLKSNDWKVKAQSVAD 504
            |||...|:.|              :.|...::.::...:.|:  :.::|.||             
Zfish   487 QFEPRLHSML--------------VTGEIKVIMIECPDLRSVINYQEVEDLK------------- 524

  Fly   505 QPDLHTIPTKTIKPSKVGVSQVKTVGKASSVRVNGSAPPPPNSAAALKREAQRKLLLEMKRQRRE 569
                |||...|:         :|..|..|:               .||.:..:::..||..:::|
Zfish   525 ----HTIRVLTL---------IKWQGPKSN---------------QLKSKFWKQVRYEMPAKKKE 561

  Fly   570 AMTAAAKLNPINVDADPDVPGIIGDSCANPSVS 602
            .|:....|       |....|:.||..|..:|:
Zfish   562 TMSRRQVL-------DSGEQGLFGDLQAVSTVA 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlcNP_001163056.1 GKAP 246..575 CDD:281368 47/264 (18%)
il1rapl2NP_001136056.1 Ig 32..133 CDD:299845
IG_like 39..133 CDD:214653
Ig 146..232 CDD:299845
IG_like 160..231 CDD:214653
I-set 247..347 CDD:254352
Ig 253..347 CDD:299845
TIR 400..558 CDD:214587 39/227 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.