DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN3-p24 and Dctn3

DIOPT Version :9

Sequence 1:NP_001261148.1 Gene:DCTN3-p24 / 46074 FlyBaseID:FBgn0010622 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_058586.3 Gene:Dctn3 / 53598 MGIID:1859251 Length:186 Species:Mus musculus


Alignment Length:188 Identity:49/188 - (26%)
Similarity:83/188 - (44%) Gaps:8/188 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAL-DI--LEKRIDALTR-VLGPVQDSEVGEGVVDALCSAHAILGEATTGSAALQQCVKRSDEL 61
            |.|| |:  |:.|::.|.| |.|| ..:.....|.|.|......||...:....::...|:.::|
Mouse     1 MAALTDVQRLQSRVEELERWVYGP-GGTRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDL 64

  Fly    62 EKYLDPNFLEEHQ-QVRSKEVYLQAVAPELHTQAEQLERIKQLEPALGAEYFRSIPAECLEQLKG 125
            .|||||.:::... ...||..::.|....:.:|...||::..|.|.|.:...:::| |...:|:.
Mouse    65 IKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVP-EHAARLQR 128

  Fly   126 ITQNNGEYAQQSELIEESLVLAMKRYGEIQAGLLSSLDAMSERLDQVEERMEQRKRAE 183
            :.|.:.:...|...|.|.....::.|.:....|........|.|.|: |..:|.|.||
Mouse   129 LAQIHIQQQDQCVAITEESKALLEGYNKTTMLLSKQFVQWDELLCQL-EAAKQVKPAE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN3-p24NP_001261148.1 Dynactin_p22 7..174 CDD:284772 40/168 (24%)
Dctn3NP_058586.3 Dynactin_p22 10..170 CDD:284772 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AG3V
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.