DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN3-p24 and dctn3

DIOPT Version :9

Sequence 1:NP_001261148.1 Gene:DCTN3-p24 / 46074 FlyBaseID:FBgn0010622 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001002220.1 Gene:dctn3 / 431767 ZFINID:ZDB-GENE-040704-65 Length:187 Species:Danio rerio


Alignment Length:181 Identity:42/181 - (23%)
Similarity:79/181 - (43%) Gaps:27/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDILEKRIDALTRVLG--------PVQDSEVGEGVVDALCSAHAILGEATTGSAALQQCVKRSDE 60
            |.:|||      ||.|        ||:.:|       :|....|.|.........::...|:.::
Zfish    14 LQLLEK------RVYGERGGKNGKPVKCAE-------SLTRISAALANTANKRERVKILHKKIED 65

  Fly    61 LEKYLDPNFLEEHQQVRSKEVYLQAVAPE---LHTQAEQLERIKQLEPALGAEYFRSIPAECLEQ 122
            |.|||||.|.:......|  |.|:.:..|   |.:||..||:::.::|.|.:.:.:::| |...:
Zfish    66 LLKYLDPQFTDFIAVPDS--VKLEFILAEEEFLRSQAALLEQVQNMQPLLDSNHIKAVP-ELTTK 127

  Fly   123 LKGITQNNGEYAQQSELIEESLVLAMKRYGEIQAGLLSSLDAMSERLDQVE 173
            ::.::|.:.:...|:|.:...:....:.|.::...|........|.|..:|
Zfish   128 VQRLSQIHIQQQDQNEDLSAEVKRLFEEYNKMMFLLSKQFSQWDETLRTLE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN3-p24NP_001261148.1 Dynactin_p22 7..174 CDD:284772 41/178 (23%)
dctn3NP_001002220.1 Dynactin_p22 10..172 CDD:284772 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AG3V
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1444664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.