DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCTN3-p24 and DCTN3

DIOPT Version :9

Sequence 1:NP_001261148.1 Gene:DCTN3-p24 / 46074 FlyBaseID:FBgn0010622 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_009165.1 Gene:DCTN3 / 11258 HGNCID:2713 Length:186 Species:Homo sapiens


Alignment Length:183 Identity:49/183 - (26%)
Similarity:84/183 - (45%) Gaps:7/183 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDILEKRIDALTR-VLGPVQDSEVGEGVVDALCSAHAILGEATTGSAALQQCVKRSDELEKYLDP 67
            |..|:.|::.|.| |.|| ..:.....|.|.|......||..::....::...|:.::|.|||||
Human     7 LQRLQARVEELERWVYGP-GGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDP 70

  Fly    68 NFLEEHQ-QVRSKEVYLQAVAPELHTQAEQLERIKQLEPALGAEYFRSIPAECLEQLKGITQNNG 131
            .:::... ...||..::.|....:.:|...||::..|.|.|.:.:.:::| |...:|:.:.|.:.
Human    71 EYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVP-EHAARLQRLAQIHI 134

  Fly   132 EYAQQS-ELIEESLVLAMKRYGEIQAGLLSSLDAMSERLDQVEERMEQRKRAE 183
            :...|. |:.|||..| ::.|.:....|........|.|.|: |...|.|.||
Human   135 QQQDQCVEITEESKAL-LEEYNKTTMLLSKQFVQWDELLCQL-EAATQVKPAE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCTN3-p24NP_001261148.1 Dynactin_p22 7..174 CDD:284772 43/169 (25%)
DCTN3NP_009165.1 Dynactin_p22 10..170 CDD:311394 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AG3V
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1444664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.