DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC3 and RIX1

DIOPT Version :10

Sequence 1:NP_000247.2 Gene:MYBPC3 / 4607 HGNCID:7551 Length:1274 Species:Homo sapiens
Sequence 2:NP_012067.4 Gene:RIX1 / 856604 SGDID:S000001240 Length:763 Species:Saccharomyces cerevisiae


Alignment Length:688 Identity:123/688 - (17%)
Similarity:216/688 - (31%) Gaps:206/688 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   224 LHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRR-TSLAGGGRRISDSH 287
            ||:...|.:.|.....:...|...| ||:.        ||.:.:||.|:. ..|.|   .|.|..
Yeast   216 LHLLKIQVSDTSDDETQAHHKIYAD-SNWR--------TGLMSILSQFKPIIQLCG---EILDFE 268

Human   288 EDTGILDFSSLLKKRDSFRTPRD----SKLEAPAEEDVWEILRQAPPSEYERIAF---------Q 339
            :|..:......|...|......:    .||:..|...:|||.::........:||         :
Yeast   269 QDNELYKLIKSLPVIDESNNKEEFLPSLKLDFNAPLTLWEIPQRLSLLADMLVAFISLPTPFPIR 333

Human   340 YGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNG--QE 402
            ..:..:..:.:.|.|:   ..|....:|:|.                   ||.|:..:.|.  .:
Yeast   334 VPLGGINSLCEVLLGV---SNKYLPLKKELR-------------------HDNELNGVINTILPQ 376

Human   403 IQMSG--------SKY------IFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPP 453
            ||..|        |||      .||.|.:...|.|.....:::.....|||..|.......:...
Yeast   377 IQFQGIRLWEIMVSKYGKCGLSFFEGILSSIELFIPLKKKSNNEIDFNVVGSLKFEFATVFRLVN 441

Human   454 VLITRPLEDQL---VMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIIN 515
            ::::. |..||   .::.|.:|....:|.:    |.|.|.:...|:...|.:.|....:......
Yeast   442 MILSH-LGHQLNIISVISQLIEVALFLSHD----KTLIDSLFKNRKSIMKQQTKTKQSKRSKSAE 501

Human   516 EAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKN 580
            .|..:...|           .||.|.:..:..:..|.|..:.|.:.               |   
Yeast   502 GAFSDIYTH-----------PELFVCKNSMNWFNEINDFFITALNN---------------W--- 537

Human   581 GKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFA----CNL----SAKLHFMEVKID 637
               ::|.:    .|| ::.|.:|.......|. :.::||.|.    |.:    |.::..:.:.|.
Yeast   538 ---ILPST----PHI-QILKYSITQSLRLKER-FGYIPESFVNLLRCEVLHPGSERVSILPIAIS 593

Human   638 FVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
            .:.........|.|..::|      .|...:|..|:                             
Yeast   594 LLKNINDDMFELLCHPKVP------VGMVYQLHKPL----------------------------- 623

Human   703 EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT---------VTVKNPVG 758
             |.|:              :|.||.:..| :.:.|.|.:...:.|:.|         ||:..|..
Yeast   624 -DLGE--------------DGEVRDDINK-KEVETNESSSNANTGLETLKALENLENVTIPEPKH 672

Human   759 EDQVNLTVKVIDVPDAPAAPKISNVGEDSCT-----VQW-EPPAYDGGQPILGYILERKKKKSYR 817
            |     ..||:|.........:..|.|...|     |:: |....|.|:.::       .||:  
Yeast   673 E-----VPKVVDDTAIFKKRSVEEVIERESTSSHKKVKFVEETTVDNGEELI-------VKKA-- 723

Human   818 WMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMS 855
                    :.:...|.:.|.:....|...:.:.||.:|
Yeast   724 --------VSQTKEEEKPMEDSEDEEQEEFEIPAIELS 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC3NP_000247.2 Ig 12..94 CDD:472250
Ig strand B 27..31 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 87..90 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..153
IgI_C1_MyBP-C_like 156..256 CDD:409554 8/31 (26%)
Ig strand A 157..160 CDD:409554
Ig strand A' 163..166 CDD:409554
Ig strand B 171..178 CDD:409554
Ig strand C 187..192 CDD:409554
Ig strand C' 197..199 CDD:409554
Ig strand D 207..215 CDD:409554
Ig strand E 222..226 CDD:409554 1/1 (100%)
Ig strand F 236..243 CDD:409554 0/6 (0%)
Ig strand G 247..256 CDD:409554 3/8 (38%)
THB 320..353 CDD:465725 5/41 (12%)
IgI_C2_MyBP-C-like 367..449 CDD:409559 21/97 (22%)
Ig strand A 367..369 CDD:409559 1/1 (100%)
Ig strand A' 372..376 CDD:409559 0/3 (0%)
Ig strand B 380..386 CDD:409559 0/5 (0%)
Ig strand C 393..398 CDD:409559 1/4 (25%)
Ig strand C' 401..404 CDD:409559 0/2 (0%)
Ig strand D 410..415 CDD:409559 3/10 (30%)
Ig strand E 418..423 CDD:409559 1/4 (25%)
Ig strand F 432..438 CDD:409559 0/5 (0%)
Ig strand G 441..449 CDD:409559 1/7 (14%)
Ig 456..541 CDD:472250 16/87 (18%)
Ig strand B 471..475 CDD:409353 1/3 (33%)
Ig strand C 483..487 CDD:409353 1/3 (33%)
Ig strand E 510..514 CDD:409353 0/3 (0%)
Ig strand F 524..530 CDD:409353 1/5 (20%)
Ig strand G 534..537 CDD:409353 0/2 (0%)
Ig 553..617 CDD:472250 9/63 (14%)
Ig strand B 562..566 CDD:409353 0/3 (0%)
Ig strand C 574..578 CDD:409353 0/3 (0%)
Ig strand E 599..603 CDD:409353 1/3 (33%)
Ig_C5_MyBP-C 655..768 CDD:409475 18/121 (15%)
Ig strand A 658..662 CDD:409475 0/3 (0%)
Ig strand B 666..673 CDD:409475 1/6 (17%)
Ig strand C 679..686 CDD:409475 0/6 (0%)
Ig strand C' 688..690 CDD:409475 0/1 (0%)
Ig strand D 725..731 CDD:409475 2/5 (40%)
Ig strand E 732..739 CDD:409475 1/6 (17%)
Ig strand F 747..755 CDD:409475 4/16 (25%)
Ig strand G 758..768 CDD:409475 1/9 (11%)
FN3 772..862 CDD:238020 15/90 (17%)
FN3 870..963 CDD:238020
Ig_Titin_like 982..1062 CDD:409406
Ig strand A 982..986 CDD:409406
Ig strand B 991..997 CDD:409406
Ig strand C 1003..1009 CDD:409406
Ig strand D 1020..1025 CDD:409406
Ig strand E 1026..1032 CDD:409406
Ig strand F 1041..1049 CDD:409406
Ig strand G 1052..1062 CDD:409406
FN3 1066..1154 CDD:238020
I-set 1181..1270 CDD:400151
Ig strand B 1198..1202 CDD:409565
Ig strand C 1211..1215 CDD:409565
Ig strand E 1236..1240 CDD:409565
Ig strand F 1250..1255 CDD:409565
Ig strand G 1263..1266 CDD:409565
RIX1NP_012067.4 RIX1 8..201 CDD:429855
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.