DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC3 and TOF2

DIOPT Version :10

Sequence 1:NP_000247.2 Gene:MYBPC3 / 4607 HGNCID:7551 Length:1274 Species:Homo sapiens
Sequence 2:NP_012935.3 Gene:TOF2 / 853880 SGDID:S000001718 Length:771 Species:Saccharomyces cerevisiae


Alignment Length:743 Identity:126/743 - (16%)
Similarity:240/743 - (32%) Gaps:227/743 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   479 EEGAQVKWLKD--GVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQ--ALAELI 539
            :|..::..|:|  |.:|..|...|..|:.||      :...:|:|    .|..|..|  :|.:|.
Yeast   114 KESIEIVSLQDRHGCDLDSEFIIKDVFENDG------VVLVILKD----ELDWSRNQHISLLQLA 168

Human   540 VQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHI--GRVHKLT 602
            .|.::.:...|...::...:.      ::|.|::..:..|:...|:..|.:|.:.|  .||....
Yeast   169 RQRRRQDNKPSTKSIVTEKRK------KISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPL 227

Human   603 IDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKL 667
            ::::.|                       :..|.|.:.:::       ||  :|.|..|||.| :
Yeast   228 MNEILP-----------------------LASKYDALNKEK-------CP--MPLTSTVVASN-V 259

Human   668 RLDVPISGDPAPTVIWQ---------KAITQGNK---------------------APARPAPD-A 701
            ..||.........|:.|         .:.||..|                     |...||.: :
Yeast   260 HKDVKDHARAKEGVVTQGSDNNKENIPSSTQQQKNDGAKRAESKDLDLLRNSSEDADYEPADENS 324

Human   702 PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTV 766
            |:.:.||.:..|.......|...:.::.:...|     ||....:....:.|:|..|:       
Yeast   325 PQISFDSIDTDFQLSTTSHTNSDMHIQYSNPSS-----GAHSPRKSSLEIKVQNKKGD------- 377

Human   767 KVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI-------LGYILERKKKKSYRWMRLNFD 824
                  |.|...|  ::||:...::    |:...:..       ....:...||.|..:..:|.|
Yeast   378 ------DLPLNDK--DIGENCRRIE----AFSDEEDFNETDNDRADSFINNSKKASMGFRDINSD 430

Human   825 LIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLK 889
            | ..:|..:.  ||..|...:         |..:..|.||.|....:...|.:....:...:..|
Yeast   431 L-DSVSFNSD--IENAVQSTQ---------STKNVVSPPFFPEKELNNRLHQSQGKEALFRLVEK 483

Human   890 WRPPERVGAGGLDGYSVE------------YCPEGCSEWVAALQGLTE----HTSILVKDLP--- 935
            ..|.:.:||.....::.:            :.|.|.:: |.....:||    ...|:.||.|   
Yeast   484 EFPDKSLGAASSTSHAKDVKIQETIRKLNRFKPTGETK-VQKRNSITEPYYGKFGIMKKDKPKSI 547

Human   936 --------------------------------------TGARLLFRVRAHNM---------AGPG 953
                                                  .|::::...|..||         |..|
Yeast   548 TSKGVSLETKHFDDPNTIISGEKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMGNRSLKDIFANAG 612

Human   954 APVTTTEPVTVQEILQRP------RLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ 1012
            .|......:.|.::::.|      :::...:.....|::|...:.::....||       .|.||
Yeast   613 KPPNAASTIKVVKLMRDPVDNSKDKVEATSNSTAQEQEQVSPKLPVMNSTPGK-------RKNGQ 670

Human  1013 PLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDA 1077
            .:..   |:..:|  .:..::..|...|.:...::.:|:..|.::     .|......|.|....
Yeast   671 AIPS---SLERTP--QLKKVKVTRSHSSPSSSSSMSLESSLDSSS-----SDDSDDDSDSRNVQV 725

Human  1078 WGLNVAL--------EWKPPQDVGNTEL 1097
            ..:|...        ..||..||.:.|:
Yeast   726 KKINFKTSHGPAGNSNGKPMLDVDDNEI 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC3NP_000247.2 Ig 12..94 CDD:472250
Ig strand B 27..31 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 87..90 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..153
IgI_C1_MyBP-C_like 156..256 CDD:409554
Ig strand A 157..160 CDD:409554
Ig strand A' 163..166 CDD:409554
Ig strand B 171..178 CDD:409554
Ig strand C 187..192 CDD:409554
Ig strand C' 197..199 CDD:409554
Ig strand D 207..215 CDD:409554
Ig strand E 222..226 CDD:409554
Ig strand F 236..243 CDD:409554
Ig strand G 247..256 CDD:409554
THB 320..353 CDD:465725
IgI_C2_MyBP-C-like 367..449 CDD:409559
Ig strand A 367..369 CDD:409559
Ig strand A' 372..376 CDD:409559
Ig strand B 380..386 CDD:409559
Ig strand C 393..398 CDD:409559
Ig strand C' 401..404 CDD:409559
Ig strand D 410..415 CDD:409559
Ig strand E 418..423 CDD:409559
Ig strand F 432..438 CDD:409559
Ig strand G 441..449 CDD:409559
Ig 456..541 CDD:472250 17/65 (26%)
Ig strand B 471..475 CDD:409353
Ig strand C 483..487 CDD:409353 0/3 (0%)
Ig strand E 510..514 CDD:409353 0/3 (0%)
Ig strand F 524..530 CDD:409353 1/5 (20%)
Ig strand G 534..537 CDD:409353 1/2 (50%)
Ig 553..617 CDD:472250 10/65 (15%)
Ig strand B 562..566 CDD:409353 0/3 (0%)
Ig strand C 574..578 CDD:409353 0/3 (0%)
Ig strand E 599..603 CDD:409353 0/3 (0%)
Ig_C5_MyBP-C 655..768 CDD:409475 27/143 (19%)
Ig strand A 658..662 CDD:409475 1/3 (33%)
Ig strand B 666..673 CDD:409475 2/6 (33%)
Ig strand C 679..686 CDD:409475 2/15 (13%)
Ig strand C' 688..690 CDD:409475 1/1 (100%)
Ig strand D 725..731 CDD:409475 0/5 (0%)
Ig strand E 732..739 CDD:409475 1/6 (17%)
Ig strand F 747..755 CDD:409475 1/7 (14%)
Ig strand G 758..768 CDD:409475 1/9 (11%)
FN3 772..862 CDD:238020 17/96 (18%)
FN3 870..963 CDD:238020 21/158 (13%)
Ig_Titin_like 982..1062 CDD:409406 13/79 (16%)
Ig strand A 982..986 CDD:409406 1/3 (33%)
Ig strand B 991..997 CDD:409406 0/5 (0%)
Ig strand C 1003..1009 CDD:409406 0/5 (0%)
Ig strand D 1020..1025 CDD:409406 1/4 (25%)
Ig strand E 1026..1032 CDD:409406 0/5 (0%)
Ig strand F 1041..1049 CDD:409406 0/7 (0%)
Ig strand G 1052..1062 CDD:409406 1/9 (11%)
FN3 1066..1154 CDD:238020 8/40 (20%)
I-set 1181..1270 CDD:400151
Ig strand B 1198..1202 CDD:409565
Ig strand C 1211..1215 CDD:409565
Ig strand E 1236..1240 CDD:409565
Ig strand F 1250..1255 CDD:409565
Ig strand G 1263..1266 CDD:409565
TOF2NP_012935.3 Cytokin_check_N 83..153 CDD:431263 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.