DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC3 and NET1

DIOPT Version :10

Sequence 1:NP_000247.2 Gene:MYBPC3 / 4607 HGNCID:7551 Length:1274 Species:Homo sapiens
Sequence 2:NP_012459.1 Gene:NET1 / 853369 SGDID:S000003612 Length:1189 Species:Saccharomyces cerevisiae


Alignment Length:677 Identity:128/677 - (18%)
Similarity:228/677 - (33%) Gaps:217/677 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   207 LQLHDS-YDRASKVY-----------LFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTV--H 257
            |.|.|. .|:..|:|           |.:....|..|.|.        .||.|:.:|....:  :
Yeast    85 LNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLDPDFL--------VKDVFNVNNIVRVILKN 141

Human   258 EAMGTGDLD------LLSAFRRTSLAGGG-------RRISDSHEDTGILDFSSLLKKRDSFRTPR 309
            |.    |||      |..:.:|:.|..|.       ::|..|   :|:|   .:.|||....|..
Yeast   142 EI----DLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSS---SGVL---RIAKKRPPTGTTT 196

Human   310 DSKLEAPAEEDV---WEILRQ--APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKL 369
            .:.:.:.....:   ..:.||  .|||.                 |.:.....||.:....:..|
Yeast   197 TTTIRSATNGSMRVSTPLARQIYPPPSS-----------------KIVSNNSDDEDEDIGERSFL 244

Human   370 EPAYQ-----------VSKGHKIRLTV---ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT 420
            .|..|           :..|.||:.::   ::....|.|...|..|:..:||:. |..::...|.
Yeast   245 PPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTP-IMSTMTPNRV 308

Human   421 LTISQCSLADDAAYQCVVGGEKCSTELFV-------------KEPPVLITRPLEDQLVMVGQRVE 472
            ....|..:::.|....:|.....|:..|.             ::|||...|.....|.:...|:.
Yeast   309 TLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRIS 373

Human   473 FECEVSEEGAQVKWLKDG----VELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQ 533
               |:.:|      ||:|    ..:...:..|...||           ..||:..:|....|...
Yeast   374 ---EIEKE------LKEGPSSPASILPAKAAKIPMKK-----------PYLENGENYESDDSSSS 418

Human   534 ALAELIVQE--KKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIG 596
            ...|....|  .|..:.:|              :..::|.|  |..:||..  :.|:.....|:.
Yeast   419 ENQETPETEPHSKASLQRS--------------QSSIADNN--GSPVKNSP--LGDAMPHNVHLA 465

Human   597 RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE---PPKIHLDCPGRIPDT 658
            .:.|.:...:|.:...:                       .:..:||   |.|..|       :|
Yeast   466 ELPKASNTSITKSSNGE-----------------------SWGKQQEHQPPRKSSL-------ET 500

Human   659 IVVVAGNKLRLDVPISGDPAPTVIWQKAIT---QGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720
            ||         :.....:|: .::..|.:|   ..|:...:      |||.|.   :.:|::|..
Yeast   501 IV---------EKKSQAEPS-GIVEPKRMTNFLDDNQVREK------EDTNDK---LLEKEILPT 546

Human   721 TEGRVR-VETTKDRSIFTVE----------GAEKEDEGVYTVTVKNPVGE-DQVNLTVKVIDVP- 772
            .....: :..:.|:|..|::          .|.|||..:...|:::...: |:|:.||::  || 
Yeast   547 IPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEVDTTVRI--VPQ 609

Human   773 --DAPAAPKISNV-----GEDSCTVQW 792
              |:.:.|| |::     |:|:...||
Yeast   610 DSDSSSFPK-SDLFKMIEGDDTDLPQW 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC3NP_000247.2 Ig 12..94 CDD:472250
Ig strand B 27..31 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 87..90 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..153
IgI_C1_MyBP-C_like 156..256 CDD:409554 14/60 (23%)
Ig strand A 157..160 CDD:409554
Ig strand A' 163..166 CDD:409554
Ig strand B 171..178 CDD:409554
Ig strand C 187..192 CDD:409554
Ig strand C' 197..199 CDD:409554
Ig strand D 207..215 CDD:409554 3/8 (38%)
Ig strand E 222..226 CDD:409554 0/3 (0%)
Ig strand F 236..243 CDD:409554 0/6 (0%)
Ig strand G 247..256 CDD:409554 2/8 (25%)
THB 320..353 CDD:465725 6/37 (16%)
IgI_C2_MyBP-C-like 367..449 CDD:409559 18/95 (19%)
Ig strand A 367..369 CDD:409559 0/1 (0%)
Ig strand A' 372..376 CDD:409559 1/14 (7%)
Ig strand B 380..386 CDD:409559 2/8 (25%)
Ig strand C 393..398 CDD:409559 1/4 (25%)
Ig strand C' 401..404 CDD:409559 1/2 (50%)
Ig strand D 410..415 CDD:409559 1/4 (25%)
Ig strand E 418..423 CDD:409559 1/4 (25%)
Ig strand F 432..438 CDD:409559 1/5 (20%)
Ig strand G 441..449 CDD:409559 1/7 (14%)
Ig 456..541 CDD:472250 16/88 (18%)
Ig strand B 471..475 CDD:409353 0/3 (0%)
Ig strand C 483..487 CDD:409353 0/3 (0%)
Ig strand E 510..514 CDD:409353 0/3 (0%)
Ig strand F 524..530 CDD:409353 1/5 (20%)
Ig strand G 534..537 CDD:409353 0/2 (0%)
Ig 553..617 CDD:472250 9/63 (14%)
Ig strand B 562..566 CDD:409353 0/3 (0%)
Ig strand C 574..578 CDD:409353 1/3 (33%)
Ig strand E 599..603 CDD:409353 1/3 (33%)
Ig_C5_MyBP-C 655..768 CDD:409475 25/127 (20%)
Ig strand A 658..662 CDD:409475 3/3 (100%)
Ig strand B 666..673 CDD:409475 0/6 (0%)
Ig strand C 679..686 CDD:409475 0/6 (0%)
Ig strand C' 688..690 CDD:409475 1/4 (25%)
Ig strand D 725..731 CDD:409475 0/6 (0%)
Ig strand E 732..739 CDD:409475 3/6 (50%)
Ig strand F 747..755 CDD:409475 1/7 (14%)
Ig strand G 758..768 CDD:409475 4/10 (40%)
FN3 772..862 CDD:238020 9/29 (31%)
FN3 870..963 CDD:238020
Ig_Titin_like 982..1062 CDD:409406
Ig strand A 982..986 CDD:409406
Ig strand B 991..997 CDD:409406
Ig strand C 1003..1009 CDD:409406
Ig strand D 1020..1025 CDD:409406
Ig strand E 1026..1032 CDD:409406
Ig strand F 1041..1049 CDD:409406
Ig strand G 1052..1062 CDD:409406
FN3 1066..1154 CDD:238020
I-set 1181..1270 CDD:400151
Ig strand B 1198..1202 CDD:409565
Ig strand C 1211..1215 CDD:409565
Ig strand E 1236..1240 CDD:409565
Ig strand F 1250..1255 CDD:409565
Ig strand G 1263..1266 CDD:409565
NET1NP_012459.1 Cytokin_check_N 71..142 CDD:431263 14/64 (22%)
PRK08581 691..>950 CDD:236304
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.