DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC3 and ECM22

DIOPT Version :10

Sequence 1:NP_000247.2 Gene:MYBPC3 / 4607 HGNCID:7551 Length:1274 Species:Homo sapiens
Sequence 2:NP_013329.1 Gene:ECM22 / 850928 SGDID:S000004218 Length:814 Species:Saccharomyces cerevisiae


Alignment Length:551 Identity:88/551 - (15%)
Similarity:167/551 - (30%) Gaps:205/551 - (37%)


- Green bases have known domain annotations that are detailed below.


Human   722 EGRVRVETTKDRSIFTVEGAE---------------------------KEDEGVYTVTVKNPVGE 759
            :|....|..||..:..|.|.:                           |.|||       .|..:
Yeast     5 DGNAGQEREKDAELIEVGGKKVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG-------KPFCK 62

Human   760 DQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDG-GQPIL---GYILERKKKKSYRWMR 820
            ...|:.:..:..|..|...|      ||.:.::....:|. |:..|   ..:|::::::.:....
Yeast    63 KCTNMKLDCVYSPIQPRRRK------DSSSSKFASAVHDRVGKKNLSDNAIMLQQQQQQLHHQQE 121

Human   821 LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT 885
            ..|...|::..: ::::..|..:.:..:.|::..|..:......:|        ||....|::|:
Yeast   122 QQFRQQQQVQLQ-QQLLPHVGTDEQSNSPNSVPPSVSNNMENLLLP--------HLLASLVNNTS 177

Human   886 VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
            .|..                            ::..|...|.:|    ..|....:......|||
Yeast   178 NSTN----------------------------SSANGAEAHNNI----TQTAPSSMINNNHPNMA 210

Human   951 GPG-----APVTTTEPVTVQEI-------------------LQRPRLQLPRHLRQTIQKKVGEPV 991
            .||     .|:|.:...|...:                   ||:|:||   ...|.|.::.|.. 
Yeast   211 LPGNSPLSIPITPSFQSTAMNLSSSLNGLLSPGRLNSVTNGLQQPQLQ---QQNQQIPQQQGTQ- 271

Human   992 NLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQV----------- 1045
               .||...|..|:....:    .|...::::..|   ||...|....:..:|.           
Yeast   272 ---SPFSNIPFDQLAQLNK----MGLNFNMKSFNT---LFPYGAANGMASEFQELFGLGKFATSN 326

Human  1046 --TVRIENMEDK-ATLVLQVVDK----PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              .:::...|:. |.:..:..||    ...|.|...|||            .:.||..|      
Yeast   327 NRAIKVSTAEEALANMQQEQEDKNKQFTKNPLDNTKTDA------------VNSGNNPL------ 373

Human  1104 KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYE 1168
                                         ||      ::|.|..||..:..|. :.|...|:|..
Yeast   374 -----------------------------NG------NENKVTASDILSHNKN-LIIDNTGLTIS 402

Human  1169 PPNYKALDFSEAPSFTQPLVNRSVIAGYTAM 1199
            ||:          :.::|.:::::.:..|.:
Yeast   403 PPH----------TLSKPSIDQNIASPSTGV 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC3NP_000247.2 Ig 12..94 CDD:472250
Ig strand B 27..31 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 87..90 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..153
IgI_C1_MyBP-C_like 156..256 CDD:409554
Ig strand A 157..160 CDD:409554
Ig strand A' 163..166 CDD:409554
Ig strand B 171..178 CDD:409554
Ig strand C 187..192 CDD:409554
Ig strand C' 197..199 CDD:409554
Ig strand D 207..215 CDD:409554
Ig strand E 222..226 CDD:409554
Ig strand F 236..243 CDD:409554
Ig strand G 247..256 CDD:409554
THB 320..353 CDD:465725
IgI_C2_MyBP-C-like 367..449 CDD:409559
Ig strand A 367..369 CDD:409559
Ig strand A' 372..376 CDD:409559
Ig strand B 380..386 CDD:409559
Ig strand C 393..398 CDD:409559
Ig strand C' 401..404 CDD:409559
Ig strand D 410..415 CDD:409559
Ig strand E 418..423 CDD:409559
Ig strand F 432..438 CDD:409559
Ig strand G 441..449 CDD:409559
Ig 456..541 CDD:472250
Ig strand B 471..475 CDD:409353
Ig strand C 483..487 CDD:409353
Ig strand E 510..514 CDD:409353
Ig strand F 524..530 CDD:409353
Ig strand G 534..537 CDD:409353
Ig 553..617 CDD:472250
Ig strand B 562..566 CDD:409353
Ig strand C 574..578 CDD:409353
Ig strand E 599..603 CDD:409353
Ig_C5_MyBP-C 655..768 CDD:409475 12/72 (17%)
Ig strand A 658..662 CDD:409475
Ig strand B 666..673 CDD:409475
Ig strand C 679..686 CDD:409475
Ig strand C' 688..690 CDD:409475
Ig strand D 725..731 CDD:409475 1/5 (20%)
Ig strand E 732..739 CDD:409475 1/6 (17%)
Ig strand F 747..755 CDD:409475 1/7 (14%)
Ig strand G 758..768 CDD:409475 1/9 (11%)
FN3 772..862 CDD:238020 14/93 (15%)
FN3 870..963 CDD:238020 16/97 (16%)
Ig_Titin_like 982..1062 CDD:409406 14/93 (15%)
Ig strand A 982..986 CDD:409406 1/3 (33%)
Ig strand B 991..997 CDD:409406 0/5 (0%)
Ig strand C 1003..1009 CDD:409406 1/5 (20%)
Ig strand D 1020..1025 CDD:409406 0/4 (0%)
Ig strand E 1026..1032 CDD:409406 2/5 (40%)
Ig strand F 1041..1049 CDD:409406 1/20 (5%)
Ig strand G 1052..1062 CDD:409406 2/10 (20%)
FN3 1066..1154 CDD:238020 14/87 (16%)
I-set 1181..1270 CDD:400151 2/19 (11%)
Ig strand B 1198..1202 CDD:409565 0/2 (0%)
Ig strand C 1211..1215 CDD:409565
Ig strand E 1236..1240 CDD:409565
Ig strand F 1250..1255 CDD:409565
Ig strand G 1263..1266 CDD:409565
ECM22NP_013329.1 GAL4 39..80 CDD:214501 8/47 (17%)
fungal_TF_MHR 508..>638 CDD:419994
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.