DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC3 and TVS1

DIOPT Version :10

Sequence 1:NP_000247.2 Gene:MYBPC3 / 4607 HGNCID:7551 Length:1274 Species:Homo sapiens
Sequence 2:NP_009987.2 Gene:TVS1 / 850425 SGDID:S000000657 Length:631 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:29/120 - (24%)
Similarity:39/120 - (32%) Gaps:23/120 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   669 LDVPIS---------GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGR 724
            |.||:|         .|..|....:......|.|...|:|.:..||      :|  .|..:|...
Yeast   187 LSVPVSLASKKEYRPVDTIPLNDLESTPVMVNSARGSPSPSSNRDT------LF--SLSSDTTTA 243

Human   725 VRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPK 779
            ......|.|.      ||.||||..|........||..|...::..:...|..|:
Yeast   244 TATNNNKRRR------AEGEDEGDNTSNHDTLRDEDYDNDDDEIASIEAPPLLPQ 292

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
MYBPC3NP_000247.2 Ig 12..94 CDD:472250
Ig strand B 27..31 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 87..90 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..153
IgI_C1_MyBP-C_like 156..256 CDD:409554
Ig strand A 157..160 CDD:409554
Ig strand A' 163..166 CDD:409554
Ig strand B 171..178 CDD:409554
Ig strand C 187..192 CDD:409554
Ig strand C' 197..199 CDD:409554
Ig strand D 207..215 CDD:409554
Ig strand E 222..226 CDD:409554
Ig strand F 236..243 CDD:409554
Ig strand G 247..256 CDD:409554
THB 320..353 CDD:465725
IgI_C2_MyBP-C-like 367..449 CDD:409559
Ig strand A 367..369 CDD:409559
Ig strand A' 372..376 CDD:409559
Ig strand B 380..386 CDD:409559
Ig strand C 393..398 CDD:409559
Ig strand C' 401..404 CDD:409559
Ig strand D 410..415 CDD:409559
Ig strand E 418..423 CDD:409559
Ig strand F 432..438 CDD:409559
Ig strand G 441..449 CDD:409559
Ig 456..541 CDD:472250
Ig strand B 471..475 CDD:409353
Ig strand C 483..487 CDD:409353
Ig strand E 510..514 CDD:409353
Ig strand F 524..530 CDD:409353
Ig strand G 534..537 CDD:409353
Ig 553..617 CDD:472250
Ig strand B 562..566 CDD:409353
Ig strand C 574..578 CDD:409353
Ig strand E 599..603 CDD:409353
Ig_C5_MyBP-C 655..768 CDD:409475 27/107 (25%)
Ig strand A 658..662 CDD:409475
Ig strand B 666..673 CDD:409475 2/3 (67%)
Ig strand C 679..686 CDD:409475 1/6 (17%)
Ig strand C' 688..690 CDD:409475 0/1 (0%)
Ig strand D 725..731 CDD:409475 0/5 (0%)
Ig strand E 732..739 CDD:409475 1/6 (17%)
Ig strand F 747..755 CDD:409475 2/7 (29%)
Ig strand G 758..768 CDD:409475 3/9 (33%)
FN3 772..862 CDD:238020 2/8 (25%)
FN3 870..963 CDD:238020
Ig_Titin_like 982..1062 CDD:409406
Ig strand A 982..986 CDD:409406
Ig strand B 991..997 CDD:409406
Ig strand C 1003..1009 CDD:409406
Ig strand D 1020..1025 CDD:409406
Ig strand E 1026..1032 CDD:409406
Ig strand F 1041..1049 CDD:409406
Ig strand G 1052..1062 CDD:409406
FN3 1066..1154 CDD:238020
I-set 1181..1270 CDD:400151
Ig strand B 1198..1202 CDD:409565
Ig strand C 1211..1215 CDD:409565
Ig strand E 1236..1240 CDD:409565
Ig strand F 1250..1255 CDD:409565
Ig strand G 1263..1266 CDD:409565