DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynG and Atp5mg

DIOPT Version :9

Sequence 1:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_997681.2 Gene:Atp5mg / 300677 RGDID:1303259 Length:103 Species:Rattus norvegicus


Alignment Length:97 Identity:51/97 - (52%)
Similarity:66/97 - (68%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVR 67
            :||.|...:|...:|.::|:|..|..||:|||.|||..:||...|.:.:||..|:||.:|:|||:
  Rat     7 NLADKAPSMVAAAVTYSKPRLATFWHYARVELVPPTLGEIPTAIQSMKSIIHSAQTGNFKHLTVK 71

  Fly    68 EAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV 99
            ||.||.||..||..||||||.||||.||||:|
  Rat    72 EAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 46/90 (51%)
Atp5mgNP_997681.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354190
Domainoid 1 1.000 94 1.000 Domainoid score I7292
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H86074
Inparanoid 1 1.050 100 1.000 Inparanoid score I4901
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 1 1.000 - - otm44383
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - LDO PTHR12386
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.