DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynG and ATP5MGL

DIOPT Version :9

Sequence 1:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001159349.1 Gene:ATP5MGL / 267020 HGNCID:13213 Length:100 Species:Homo sapiens


Alignment Length:94 Identity:47/94 - (50%)
Similarity:59/94 - (62%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVR 67
            :|..|...|||..:|..:|:|..|..|..|||.|||||:||...|.|..|:..|:||::|.|||:
Human     7 NLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFKQLTVK 71

  Fly    68 EAWLNTLVTAEVIFWFYIGECIGKRHIVG 96
            ||.||.||..||..|||:.|..|||.|:|
Human    72 EALLNGLVATEVSTWFYVREITGKRGIIG 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 46/91 (51%)
ATP5MGLNP_001159349.1 ATP-synt_G 16..100 CDD:309729 43/83 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160124
Domainoid 1 1.000 106 1.000 Domainoid score I6578
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4902
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 1 1.000 - - otm41889
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12386
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.