DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynG and atp20

DIOPT Version :9

Sequence 1:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_593034.1 Gene:atp20 / 2541878 PomBaseID:SPAC22F3.07c Length:118 Species:Schizosaccharomyces pombe


Alignment Length:71 Identity:16/71 - (22%)
Similarity:30/71 - (42%) Gaps:16/71 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVREAW-LNTLVTAEVIFWFYIGECIGKR 92
            |...::.||:....|.:              .:|:.: .||| .|..:..|::..|..|:.:|:|
pombe    63 YHSQKIAPPSNTHSPFL--------------FWKSQS-SEAWGRNFFIAVEIVGIFCAGQMVGRR 112

  Fly    93 HIVGYN 98
            .|..|:
pombe   113 KITPYH 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 15/68 (22%)
atp20NP_593034.1 ATP-synt_G 47..118 CDD:282561 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - LDO PTHR12386
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.