powered by:
Protein Alignment ATPsynG and atp20
DIOPT Version :9
Sequence 1: | NP_001036353.1 |
Gene: | ATPsynG / 46069 |
FlyBaseID: | FBgn0010612 |
Length: | 99 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_593034.1 |
Gene: | atp20 / 2541878 |
PomBaseID: | SPAC22F3.07c |
Length: | 118 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 30/71 - (42%) |
Gaps: | 16/71 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 YAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVREAW-LNTLVTAEVIFWFYIGECIGKR 92
|...::.||:....|.: .:|:.: .||| .|..:..|::..|..|:.:|:|
pombe 63 YHSQKIAPPSNTHSPFL--------------FWKSQS-SEAWGRNFFIAVEIVGIFCAGQMVGRR 112
Fly 93 HIVGYN 98
.|..|:
pombe 113 KITPYH 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104623 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12386 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.