DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynG and ATP5MG

DIOPT Version :9

Sequence 1:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_006467.4 Gene:ATP5MG / 10632 HGNCID:14247 Length:103 Species:Homo sapiens


Alignment Length:97 Identity:53/97 - (54%)
Similarity:68/97 - (70%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVR 67
            :|..|...|||..:|.::|:|..|..||||||.|||||:||...|.|..|:..|:||::|.|||:
Human     7 NLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVK 71

  Fly    68 EAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV 99
            ||.||.||..||:.|||:||.||||.|:||:|
Human    72 EAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 49/90 (54%)
ATP5MGNP_006467.4 ATP-synt_G 10..101 CDD:398409 49/90 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160125
Domainoid 1 1.000 106 1.000 Domainoid score I6578
eggNOG 1 0.900 - - E1_KOG4103
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H86074
Inparanoid 1 1.050 109 1.000 Inparanoid score I4902
Isobase 1 0.950 - 0 Normalized mean entropy S3876
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 1 1.000 - - otm41889
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - LDO PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 1 1.000 - - X3021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.