DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynG and atp5mg

DIOPT Version :9

Sequence 1:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001163975.1 Gene:atp5mg / 100101800 XenbaseID:XB-GENE-923057 Length:107 Species:Xenopus tropicalis


Alignment Length:97 Identity:46/97 - (47%)
Similarity:64/97 - (65%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVR 67
            ::.||...|:...:..:||:|..|..||:||||||:||::|...:.:..::|..::|....||||
 Frog    11 AVTTKTPQLIGAAVGYSRPRLATFWYYARVELTPPSPAEVPKAIESIKGLVKSFQSGRLSELTVR 75

  Fly    68 EAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV 99
            ||..|.||..||:.||||||||||..:|||||
 Frog    76 EALRNGLVATEVLMWFYIGECIGKGGLVGYNV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 42/90 (47%)
atp5mgNP_001163975.1 ATP-synt_G 14..105 CDD:368077 42/90 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H86074
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.