DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYBPC2 and CG14964

DIOPT Version :9

Sequence 1:NP_004524.3 Gene:MYBPC2 / 4606 HGNCID:7550 Length:1141 Species:Homo sapiens
Sequence 2:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster


Alignment Length:534 Identity:139/534 - (26%)
Similarity:220/534 - (41%) Gaps:90/534 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   621 TNPV-GEDVASIFLQVVDVPDPPEAVRITSVG-----EDWAILVWEPPMYDGGKPVTGYLVERKK 679
            |:|. |....::..:..:.|.||....:|.|.     .|...|.|:.|::|||.|:|||.||.::
  Fly    10 THPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRR 74

Human   680 KGSQRWMKLNFEVFTETTYESTKM-IEGI----LYEMRVFAVNAIGVSQPSMNTKPF-MPIAPTS 738
            .||..|::.     |.|..:...: |.|:    .|:.|.||.|.:|.|..|..:.|. :.:...:
  Fly    75 MGSPHWVRA-----TPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNA 134

Human   739 EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPV---ERCGFTVKN 800
            ..:...::::.||......|...|:...|.....:.:..:|.|.:....|:.|   |.....:..
  Fly   135 ITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQ 199

Human   801 LPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQ 865
            :........:....|.||  ...|.|:.:    :..||||||||......|.:..|.|.|.|...
  Fly   200 VALTDEGEIKCTATNRAG--HVITKARLM----VQAPPKIRLPRTYEDGLIVEADEVLRLKVGVA 258

Human   866 GKPRPQVVWTKGG---APLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRI 927
            |:|.|.:.|...|   ||  ..|..|..::.:::..:....|.|.|||.:.......:|:.:..:
  Fly   259 GQPPPAITWLHEGEVIAP--GGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLV 321

Human   928 RVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWF----NVYER--- 985
            .|..:..||....:...:|.:|.:.|.||.|||..:|..|.|        |:|    ||:.:   
  Fly   322 TVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIV--------EYFRVGWNVWLKAAT 378

Human   986 NRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARIL-----KTGITFKP-----FEYK 1040
            .|..|.|:.|||.|:||.|||..||..|||:..|.|:    :|     |.||| ||     ....
  Fly   379 TRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESE----LLFIPDPKRGIT-KPKSATRIAGD 438

Human  1041 EHD--------FRMAPKFLT-----PLIDRVVVAGYSAALNCAVRGHPKPKVVWMKN-------- 1084
            |.|        .::.|:..|     |..|  ...|.|...:.:.:..|||:::..:.        
  Fly   439 EKDKPKTGAGGMQVPPRRKTLSPPRPQAD--ASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYG 501

Human  1085 ------KMEIREDP 1092
                  ||::|:.|
  Fly   502 TSDHALKMDVRKSP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYBPC2NP_004524.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
IG_like 58..153 CDD:214653
I-set 258..342 CDD:254352
Ig 283..330 CDD:299845
I-set 348..434 CDD:254352
Ig 374..441 CDD:143165
IG_like 447..>509 CDD:214653
Ig 456..>509 CDD:143165
Ig_C5_MyBP-C 550..635 CDD:143302 3/14 (21%)
IG_like 554..635 CDD:214653 3/14 (21%)
FN3 639..725 CDD:238020 32/95 (34%)
FN3 738..830 CDD:238020 15/94 (16%)
IG_like 848..929 CDD:214653 20/83 (24%)
Ig_Titin_like 857..929 CDD:143225 18/74 (24%)
FN3 934..1016 CDD:238020 33/88 (38%)
I-set 1048..1137 CDD:254352 13/64 (20%)
Ig 1067..1132 CDD:143165 7/40 (18%)
CG14964NP_647779.2 FN3 29..127 CDD:238020 34/102 (33%)
I-set 138..227 CDD:254352 15/94 (16%)
Ig 155..224 CDD:143165 11/70 (16%)
IG_like 243..323 CDD:214653 20/81 (25%)
Ig 250..323 CDD:299845 18/74 (24%)
FN3 327..411 CDD:238020 34/91 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.