DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sply and gadl1

DIOPT Version :9

Sequence 1:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_012820293.1 Gene:gadl1 / 733871 XenbaseID:XB-GENE-5721903 Length:522 Species:Xenopus tropicalis


Alignment Length:399 Identity:77/399 - (19%)
Similarity:134/399 - (33%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LPEKGLSKEEILRL----VDEHLKTGHYNWRDGRVSG-----------------AVYGYKPDLVE 146
            :.:.|...|::|:|    :...:||.|..:.:...:|                 :||.|:...|.
 Frog    89 IKDNGEPHEKLLQLCKNVIKYSVKTSHPRFFNQLYAGMDHYSLAARFITEALNPSVYTYEVSPVF 153

  Fly   147 LVTEVYGKASYTNPLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIVMAMKAYR- 210
            ::||                      ||.:.:|.  .|.|.....|..:.||:.|.:.|:...| 
 Frog   154 ILTE----------------------EAILKKMI--EFLGWKEGDGIFSPGGSVSNMYAVNLARY 194

  Fly   211 ----DFAREYKGI-TRPNIVV--PKTVHAAFDKGGQYFNI---HVRSVDVD------PETYEVDI 259
                |.  :.||: :.|.:|:  .:..|.:..|...:..|   :|..|..|      ||..|..|
 Frog   195 KYCPDI--KQKGLSSAPRLVMFTSEECHYSMKKAAAFLGIGTENVYFVKTDDRGKMIPEELENQI 257

  Fly   260 KKFKR---------AINRNTILLVGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVAL 315
            ::.|:         |.:..|:|          |..|.::.||.:..|:.:..||||..|...:  
 Frog   258 QRAKKEAAVPFLVSATSGTTVL----------GAFDPLDDIANICEKHKLWFHVDASWGGSAL-- 310

  Fly   316 VRNAGYKLRPFDFEVKGVTSISADTHKYGFA-------------------PKGSSVILYSDKKYK 361
               ...|.|.....:....|::.:.||...|                   ....:..|:...|:.
 Frog   311 ---MSQKYRKCLHGIHRADSVAWNPHKMLMAGIQCCALLVRDNSGLLKRCHSAEATYLFQQDKFY 372

  Fly   362 DHQFTVTTDWPGGVYGSPTVNGSRAGGIIAACWATMMSFGYDGYLEATKRIVDTARYIERGVRDI 426
            |.|:..         |..::..||..... ..|....:.|..|..|...|.:...||:...::..
 Frog   373 DVQYDT---------GDKSIQCSRRADAF-KFWMMWKALGTTGLEERINRALALTRYLASEIKKR 427

  Fly   427 DGIFIFGKP 435
            ||..:..:|
 Frog   428 DGFELLWEP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 70/366 (19%)
gadl1XP_012820293.1 DOPA_deC_like 118..518 CDD:99743 70/370 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.