DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sply and Csad

DIOPT Version :9

Sequence 1:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_068518.1 Gene:Csad / 60356 RGDID:621030 Length:493 Species:Rattus norvegicus


Alignment Length:279 Identity:70/279 - (25%)
Similarity:115/279 - (41%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LPEKGLSKEEILR----LVDEHLKTGHYNWRDGRVSG----AVYGYKPDLVELVTEVYGKASYTN 159
            |..:|.|:|.||.    ::...:||||..:.:...||    |:.|      .::||....:.|| 
  Rat    60 LQSQGESRERILERCRAVIHYSVKTGHPRFFNQLFSGLDPHALAG------RIITESLNTSQYT- 117

  Fly   160 PLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIVMAMKAYRDFAR----EYKGI- 219
               .::.|....||.||::....|...|:.. |....||:.|.:.|:...| |.|    :.:|: 
  Rat   118 ---YEIAPVFVLMEEEVLKKLRALVGWNTGD-GVFCPGGSISNMYAINLAR-FQRYPDCKQRGLR 177

  Fly   220 TRPNIVV--PKTVHAAFDKGGQYFNI---HVRSVDVD------PETYEVDIKKFKRAINRNTILL 273
            ..|.:.:  .|..|.:..||..:..:   .||.|..|      ||..|..| ....|......|:
  Rat   178 ALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGKMIPEDLERQI-SLAEAEGSVPFLV 241

  Fly   274 VGSAPNFPYGTIDDIEAIAALGVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEVKGVTSISA 338
            ..::.....|..|.::|||.:..::.:.:||||..|..|: |.|...:.|.    .::...|::.
  Rat   242 SATSGTTVLGAFDPLDAIADVCQRHGLWLHVDAAWGGSVL-LSRTHRHLLD----GIQRADSVAW 301

  Fly   339 DTHKYGFAPKGSSVILYSD 357
            :.||...|....|.:|..|
  Rat   302 NPHKLLAAGLQCSALLLRD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 60/246 (24%)
CsadNP_068518.1 DOPA_deC_like 89..489 CDD:99743 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.