DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sply and ddc

DIOPT Version :9

Sequence 1:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_998507.1 Gene:ddc / 406651 ZFINID:ZDB-GENE-040426-2656 Length:480 Species:Danio rerio


Alignment Length:285 Identity:50/285 - (17%)
Similarity:102/285 - (35%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ETLPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPD-------LVELVTEVYGKASYT 158
            |..||:..|.|::::.::..:..|..:|.    |...|.|.|.       |.:::....|...::
Zfish    44 EEAPEEPESYEDVVKDIERVIMPGVTHWH----SPYFYAYFPTAHSYPAMLADILCGAIGCIGFS 104

  Fly   159 ---NPLHADLFPGVCKMEAEVVRMACNLFHG----------NSASCGTMTT--GGTESIVMAMKA 208
               :|...:|...:.....:::::..:...|          ::||..|:.|  .....||..::|
Zfish   105 WAASPACTELETVMLDWLGKMLKLPEDFLAGTKGKGGGVIQSTASEATLITLLAARSKIVRLIQA 169

  Fly   209 YRDFAREYKGITRPNIVVPKTVHAAFDKGGQYFNIHVRSVDVDP------ETYEVDIKKFKRAIN 267
            ......|...|::.........|::.::.|....:.::.:..|.      :..|..:|:.|.|  
Zfish   170 DHPDRSETDIISKLVAYSSDQAHSSVERAGLIGGVRMKKIPTDSKFSVRGDALERILKEDKAA-- 232

  Fly   268 RNTILLVGSAPNFPYGTIDD-----IEAIAALGVKYDIPV--------HVDAC-LGSFVVALVRN 318
                   |..|.|...|:..     .:.|..||     |:        |:||. .||..:.    
Zfish   233 -------GLIPFFFCATLGTTASCAFDCITELG-----PICNAEKMWMHIDAAYAGSAFIC---- 281

  Fly   319 AGYKLRPFDFEVKGVTSISADTHKY 343
              .:.||....::...|.:.:.||:
Zfish   282 --PEFRPLLNGIEFADSFNFNPHKW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 43/254 (17%)
ddcNP_998507.1 AAT_I 1..478 CDD:302748 50/285 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.