DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sply and Ddc

DIOPT Version :9

Sequence 1:NP_652032.1 Gene:Sply / 46059 FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001257781.1 Gene:Ddc / 24311 RGDID:2494 Length:480 Species:Rattus norvegicus


Alignment Length:274 Identity:46/274 - (16%)
Similarity:107/274 - (39%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TLPEKGLSKEEILRLVDEHLKTGHYNWRDGRVSGAVYGYKPD-------LVELVTEVYGKASYT- 158
            |.|::..:.|:|:|.:::.:..|..:|.    |...:.|.|.       |.:::....|...:: 
  Rat    45 TAPQEPETYEDIIRDIEKIIMPGVTHWH----SPYFFAYFPTASSYPAMLADMLCGAIGCIGFSW 105

  Fly   159 --NPLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTG-GTESIVMAMKAYRDFAREYKGIT 220
              :|...:|...:.....:::.:......|.:...|.:..| .:|:.::|:.|.|..........
  Rat   106 AASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKMIRQLQAA 170

  Fly   221 RPNI----VVPKTV-------HAAFDKGGQYFNIHVRSVDVDPETYEVDIKKFKRAINRNTILLV 274
            .|.:    ::.|.|       |::.::.|....:.::::..| ..|.:.....:.|:.|:.  ..
  Rat   171 SPELTQAALMEKLVAYTSDQAHSSVERAGLIGGVKIKAIPSD-GNYSMRAAALREALERDK--AA 232

  Fly   275 GSAPNFPYGTI--------DDIEAIAALGVKYDIPVHVDACL--GSFVVALVRNAGYKLRPFDFE 329
            |..|.|...|:        |::..:..:..:..:.:|:||..  .:|:....|   |.|...:| 
  Rat   233 GLIPFFVVVTLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFR---YLLNGVEF- 293

  Fly   330 VKGVTSISADTHKY 343
               ..|.:.:.||:
  Rat   294 ---ADSFNFNPHKW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 39/244 (16%)
DdcNP_001257781.1 Pyridoxal_deC 35..414 CDD:278699 46/274 (17%)
2 X approximate tandem repeats 58..178 18/123 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.