Sequence 1: | NP_652031.2 | Gene: | Prosbeta1 / 46058 | FlyBaseID: | FBgn0010590 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571753.1 | Gene: | psmb9b / 64281 | ZFINID: | ZDB-GENE-001208-3 | Length: | 227 | Species: | Danio rerio |
Alignment Length: | 210 | Identity: | 100/210 - (47%) |
---|---|---|---|
Similarity: | 137/210 - (65%) | Gaps: | 9/210 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 TDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIAD 72
Fly 73 IVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTR 137
Fly 138 ESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERR 202
Fly 203 --------IFYNTES 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta1 | NP_652031.2 | 20S_bact_beta | 15..201 | CDD:163402 | 96/185 (52%) |
proteasome_beta_type_6 | 16..203 | CDD:239731 | 96/194 (49%) | ||
psmb9b | NP_571753.1 | PRE1 | 17..198 | CDD:223711 | 96/181 (53%) |
proteasome_beta_type_6 | 18..204 | CDD:239731 | 96/186 (52%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |