DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb9b

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_571753.1 Gene:psmb9b / 64281 ZFINID:ZDB-GENE-001208-3 Length:227 Species:Danio rerio


Alignment Length:210 Identity:100/210 - (47%)
Similarity:137/210 - (65%) Gaps:9/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIAD 72
            |:..:..||||:|||||||||:|:|||.|:||.|.|||.:||:.:.||:||..||||||.|.||:
Zfish    10 TNGGLGMGTTIIAVEFDGGVVVGSDSRVSAGASVVNRVMNKLSPLHDKIYCALSGSAADAQTIAE 74

  Fly    73 IVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTR 137
            ||.|.|:.|..:.::|.||..||:..:|..|.|:|.|.|.:||||||.:.|||||: .|.|:|||
Zfish    75 IVNYQLDVHSIEVDEDPLVCSAATLVKNISYKYKEELSAHLIVAGWDRREGGQVYA-TLSGLLTR 138

  Fly   138 ESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERR 202
            :...:|||||.:|||||...||..|..::|..||..::..|:..|||||||..:..|..:.:|.:
Zfish   139 QPFAVGGSGSFYIYGFVDAEYRAGMTKKECQEFVINSLSLAMGRDGSSGGVAYLVTIDSESVEEK 203

  Fly   203 --------IFYNTES 209
                    .||:.::
Zfish   204 CILGNQLPTFYDPDT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 96/185 (52%)
proteasome_beta_type_6 16..203 CDD:239731 96/194 (49%)
psmb9bNP_571753.1 PRE1 17..198 CDD:223711 96/181 (53%)
proteasome_beta_type_6 18..204 CDD:239731 96/186 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.