DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb12

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_571751.1 Gene:psmb12 / 64279 ZFINID:ZDB-GENE-001208-1 Length:217 Species:Danio rerio


Alignment Length:190 Identity:89/190 - (46%)
Similarity:130/190 - (68%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSG-AYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVA 75
            |||||||:||:|:|||:||:|||.|.| :||:::..:||.::.|:::||.:||.||.||:..:..
Zfish    13 VSTGTTILAVKFNGGVIIGSDSRASMGESYVSSKTINKLIQVHDRIFCCIAGSLADAQAVTKMAK 77

  Fly    76 YSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESC 140
            :.|::|..|.....||..|||..|..|||.:|.|.||.|.||||.::|.|:|.:.|||||..:..
Zfish    78 FQLSFHSIQMESPPLVKAAASIMRELCYSNKEELRAGFITAGWDRKKGPQIYVVSLGGMLLSQPF 142

  Fly   141 TIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIE 200
            |||||||::|||:|...::|:|.||:...|...|:..|:..|..|||||.:.:||:.|::
Zfish   143 TIGGSGSTYIYGYVDAKFKPDMTLEEATQFSTNALALAMGRDNVSGGVVHLVVITEAGVK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 86/187 (46%)
proteasome_beta_type_6 16..203 CDD:239731 85/186 (46%)
psmb12NP_571751.1 20S_bact_beta 16..211 CDD:163402 86/187 (46%)
proteasome_beta_type_6 17..205 CDD:239731 85/186 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575763
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0174
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54145
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101390
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.