DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and PSMB10

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:214 Identity:67/214 - (31%)
Similarity:103/214 - (48%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYSL 78
            |||||..:.|..||::|||:|.::.:.||::..:|:..|..|:|||.:|.|||.:....:||..:
Human    38 TGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKM 102

  Fly    79 NYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIG 143
            ..|...|.::..|.......|...:.|:..:.|.:||.|.| ..|.|:|.:...|..:|...|..
Human   103 ELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVD-LTGPQLYGVHPHGSYSRLPFTAL 166

  Fly   144 GSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDG---------- 198
            |||.......:.:.::|||.||.....:.:||...|..|..|||.|...:|||.|          
Human   167 GSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSP 231

  Fly   199 ---IERRIFYNTESGASAV 214
               ::|...|:...|.:||
Human   232 TEPVKRSGRYHFVPGTTAV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 61/198 (31%)
proteasome_beta_type_6 16..203 CDD:239731 61/199 (31%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 60/187 (32%)
Pr_beta_C 232..267 CDD:403609 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.