DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and PSMB9

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_002791.1 Gene:PSMB9 / 5698 HGNCID:9546 Length:219 Species:Homo sapiens


Alignment Length:204 Identity:107/204 - (52%)
Similarity:137/204 - (67%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DTP----VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQA 69
            |.|    |.|||||||||||||||:|:|||.|:|..|.|||.|||:.:.:::||..||||||.||
Human    10 DLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQA 74

  Fly    70 IADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGM 134
            :||:.||.|..|..:..:..||..||:..||..|.|||.|.|.::|||||::.|||||. .||||
Human    75 VADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYG-TLGGM 138

  Fly   135 LTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGI 199
            |||:...||||||:||||:|...|:|.|:.|:|..|...|:..|:..|||||||:.:..||..|:
Human   139 LTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGV 203

  Fly   200 ERRIFYNTE 208
            :.|:....|
Human   204 DHRVILGNE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 101/185 (55%)
proteasome_beta_type_6 16..203 CDD:239731 100/186 (54%)
PSMB9NP_002791.1 proteasome_beta_type_6 21..207 CDD:239731 100/186 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0174
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54145
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 1 1.000 - - otm40301
orthoMCL 1 0.900 - - OOG6_101390
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1014
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.