DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb9

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001003660.1 Gene:psmb9 / 445259 XenbaseID:XB-GENE-481018 Length:215 Species:Xenopus tropicalis


Alignment Length:203 Identity:100/203 - (49%)
Similarity:133/203 - (65%) Gaps:9/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAY 76
            |||||||:|||||||||:|:|||.|:|..|.|||.:||..:..::||..||||||.||:||:..|
 Frog    13 VSTGTTIIAVEFDGGVVVGSDSRVSAGDAVVNRVFNKLAPVHQRIYCALSGSAADAQAVADMAHY 77

  Fly    77 SLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCT 141
            .:..|..:.....||..||:..:...|.|:|.::|.:||||||.:.|||||. .||||:||:...
 Frog    78 HMEVHSVEMEAPPLVLAAANLIKGISYKYKEEIVAHLIVAGWDSKNGGQVYG-TLGGMITRQPFA 141

  Fly   142 IGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIERRI--- 203
            ||||||::|||||...::|.|:.|:|..|..:|:..|...|||||||:.:..:||:|...||   
 Frog   142 IGGSGSTYIYGFVDSTFKPGMSREECEKFAVQALSLATERDGSSGGVIYLVTVTKEGTTDRIISG 206

  Fly   204 -----FYN 206
                 |||
 Frog   207 DNIPRFYN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 92/185 (50%)
proteasome_beta_type_6 16..203 CDD:239731 91/186 (49%)
psmb9NP_001003660.1 PRE1 8..203 CDD:223711 95/190 (50%)
proteasome_beta_type_6 17..203 CDD:239731 91/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.