DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:171 Identity:33/171 - (19%)
Similarity:66/171 - (38%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAI 70
            ::....|..|:|.:.|.....||:|.: ::|......:|...|::.:...|....:|..||.:.:
  Fly    22 EYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARIL 85

  Fly    71 -----ADIVAYSLNYHENQTNKDALVFEAASEFRNY--CYSYRESLLAGI--IVAGWDEQRGGQV 126
                 .:..::.||: |||...:.:....|...:.|  |...|.   .||  ::.|.|.....::
  Fly    86 INRGQVECQSHRLNF-ENQVTLEYITRYLAQLKQKYTQCNGRRP---FGISCLIGGIDADGSARL 146

  Fly   127 YSIPLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDC 167
            :.....|:......|..|..::.:..|..:.|..:.....|
  Fly   147 FHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 32/162 (20%)
proteasome_beta_type_6 16..203 CDD:239731 31/161 (19%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 33/171 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 33/171 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.