DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:186 Identity:48/186 - (25%)
Similarity:86/186 - (46%) Gaps:2/186 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 STGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYS 77
            :||||::.:.|||||:|||:||.:||..|.::...|:..:...::...:|:|.||:|:.::....
  Fly    47 TTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQ 111

  Fly    78 LNYHENQTN-KDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCT 141
            |..|...|. :...|..|....|...:.:..::.|.:|:.|.| ..|..::.....|.......|
  Fly   112 LELHRMNTGFRKVPVCCANQMIRQLLFRFNGNIDADMIIGGAD-NTGAHLFCTRSDGSTDTAPFT 175

  Fly   142 IGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKD 197
            ..|||.......:...:..:::.|........||...:.:|..|||.|.:.::..|
  Fly   176 SIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 47/184 (26%)
proteasome_beta_type_6 16..203 CDD:239731 46/183 (25%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 47/181 (26%)
proteasome_beta_type_7 50..239 CDD:239732 46/183 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441189
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.