DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and psmb6

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_989151.1 Gene:psmb6 / 394756 XenbaseID:XB-GENE-6257763 Length:233 Species:Xenopus tropicalis


Alignment Length:220 Identity:125/220 - (56%)
Similarity:159/220 - (72%) Gaps:8/220 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQ 68
            |.|:....||||||||||||||||||||||||::|||:|||||||||.:.|:::|||||||||||
 Frog    22 DMDWMGREVSTGTTIMAVEFDGGVVIGADSRTTTGAYIANRVTDKLTPVHDRIFCCRSGSAADTQ 86

  Fly    69 AIADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGG 133
            ||||.|.|.|.:|..:.:...||..||:.|:..||.|||.|:|||||||||:::|||||::|:||
 Frog    87 AIADAVTYQLGFHSIELDGLPLVHTAANLFKEMCYRYREDLMAGIIVAGWDKRKGGQVYTVPMGG 151

  Fly   134 MLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDG 198
            |:..:..:|||||||:|||||...||..|..|:|:.|...|:..|:..|||||||:|:..||:.|
 Frog   152 MMVHQPFSIGGSGSSYIYGFVDSTYRSGMTKEECLKFTANALALAMERDGSSGGVIRLAAITEGG 216

  Fly   199 IERRIFYNTESGASAVSSTPSFISS 223
            :||::....|        .|.|.||
 Frog   217 VERQVILGNE--------LPRFPSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 113/185 (61%)
proteasome_beta_type_6 16..203 CDD:239731 114/186 (61%)
psmb6NP_989151.1 proteasome_beta_type_6 34..221 CDD:239731 114/186 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2266
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I3102
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172133at2759
OrthoFinder 1 1.000 - - FOG0001868
OrthoInspector 1 1.000 - - oto102264
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1224
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.