DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:72/177 - (40%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAAD---- 66
            ::....|..|:|:|.:..:..:|||.:.| |.|.....|:..|:..:.|.|....||..||    
  Fly    22 EYAQEAVRRGSTVMGLRTNNAIVIGVEKR-SVGDLQEERMVRKICMLDDHVVMTFSGLTADARIL 85

  Fly    67 -TQAIADIVAYSLNYHENQTNKDALVFEAASEFRNYCYSY-RESLLAGIIVAGWDEQRGGQVYSI 129
             ::|..:..::.||: |..|..:.:....|...:||..|. |.......:|.|:||.....::..
  Fly    86 VSRAQMEAQSHRLNF-EKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSCLVGGFDEDGTPHLFQT 149

  Fly   130 PLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQ 176
            ...|:.........|..|..:..::.:|....:.:.|....:|..|:
  Fly   150 DPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 38/168 (23%)
proteasome_beta_type_6 16..203 CDD:239731 37/167 (22%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 39/177 (22%)
Ntn_hydrolase 5..214 CDD:294319 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.