DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:217 Identity:40/217 - (18%)
Similarity:79/217 - (36%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAY 76
            :..|:|.:.:....|||:..:.|.:|...|.:.| :|:..:...:.|..||..||.:.:.:....
  Fly    31 IKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV-EKIVEVDKHIGCATSGLMADARTLIERARV 94

  Fly    77 SLNYHENQTNKDALVFEAASEFRNYCYSYRES-----------------LLAGIIVAGWDEQRGG 124
            ....|....|:...:...|.........:.:|                 |.|||      |....
  Fly    95 ECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGI------EAGQP 153

  Fly   125 QVYSIPLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVV 189
            |::.:...|...|......||||......:::.:||::.|::.:......::..:....:|..|.
  Fly   154 QLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNSTNVE 218

  Fly   190 --------RIGIITKDGIERRI 203
                    ...:.||:.:|:.|
  Fly   219 VMTMTKEREFYMFTKEEVEQHI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 38/210 (18%)
proteasome_beta_type_6 16..203 CDD:239731 38/211 (18%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 40/217 (18%)
proteasome_alpha_type_5 8..222 CDD:239722 36/197 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.