DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta1 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:59/167 - (35%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PD-----FDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSG 62
            ||     .|:....|....|::.:.....||:..:...:|..|..: ...::..|...:....:|
  Fly    17 PDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPD-AGGRIFTIEKNIGMAVAG 80

  Fly    63 SAADTQAIADIVAY-SLNYHENQTNKDALVFEAASEFRNYC------------YSYRESLLAGII 114
            ..||...:|||... :.||.:.        ||.|...::.|            ||........||
  Fly    81 LVADGNFVADIARQEAANYRQQ--------FEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137

  Fly   115 VAGWDEQRGGQVYSIPLGGMLTRESCTIGGSGSSFIY 151
            :|.|||..|.|:|.|.             .|||||.|
  Fly   138 LASWDEVEGPQLYKIE-------------PSGSSFGY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 36/150 (24%)
proteasome_beta_type_6 16..203 CDD:239731 36/149 (24%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 40/167 (24%)
PRE1 6..231 CDD:223711 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.